Gene Rv1472
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Could possibly oxidize fatty acids using specific components [catalytic activity: (3S)-3-hydroxyacyl-CoA = trans-2(or 3)-enoyl-CoA + H(2)O]. |
| Product | Possible enoyl-CoA hydratase EchA12 (enoyl hydrase) (unsaturated acyl-CoA hydratase) (crotonase) |
| Comments | Rv1472, (MTV007.19), len: 285 aa. Possible echA12, enoyl-CoA hydratase, highly similar to P53526|ECHH_MYCLE|NP_301896.1|NC_002677 possible enoyl-CoA hydratase/isomerase from Mycobacterium leprae (294 aa), FASTA scores: opt: 1265, E(): 0, (72.0% identity in 271 aa overlap). Also similar to others e.g. CAA66096.1|X97452 enoyl-CoA isomerase from Escherichia coli strain K12 (262 aa); CAC44593.1|AL596162 putative enoyl-CoA hydratase from Streptomyces coelicolor (275 aa); etc. Also similar to others from Mycobacterium tuberculosis e.g. ECHA16|Rv2831|MTCY16B7.11c (249 aa), FASTA scores: opt: 232, E(): 1.3e-15, (33.8% identity in 204 aa overlap); etc. |
| Functional category | Lipid metabolism |
| Proteomics | Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). |
| Transcriptomics | mRNA identified by microarray analysis and up-regulated after 24h and 96h of starvation (see citation below). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1659763 | 1660620 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1472|echA12
VPHRCAAQVVAGYRSTVSLVLVEHPRPEIAQITLNRPERMNSMAFDVMVPLKEALAQVSYDNSVRVVVLTGAGRGFSPGADHKSAGVVPHVENLTRPTYALRSMELLDDVILMLRRLHQPVIAAVNGPAIGGGLCLALAADIRVASSSAYFRAAGINNGLTASELGLSYLLPRAIGSSRAFEIMLTGRDVSAEEAERIGLVSRQVPDEQLLDACYAIAARMAGFSRPGIELTKRTLWSGLDAASLEAHMQAEGLGQLFVRLLTANFEEAVAARAEQRAPVFTDDT
Bibliography
- Betts JC et al. [2002]. Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Transcriptome
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
