Gene Rv1473A
in Mycobacterium tuberculosis H37Rv
General annotation
Type | CDS |
Function | Possibly involved in transcriptional mechanism |
Product | Possible transcriptional regulatory protein |
Comments | Rv1473A, len: 63 aa. Possible transcriptional regulator, CDS predicted by GC plot. Similar to SCI8.24c|AL132644_24 putative transcriptional regulator from Streptomyces coelicolor (73 aa), FASTA scores: opt: 210, E(): 1.5e-08, (56.15% identity in 57 aa overlap). |
Functional category | Regulatory proteins |
Mutant | Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 1662381 | 1662572 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1473A|Rv1473A MRKSKKTRDQLLRELRNAYEGGASIRNLAATTGRSYGSIHSMLRESGTTMRGRGGPNRRSRPR
Bibliography
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant