Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown, but supposedly involved in virulence
ProductPossible invasion protein
CommentsRv1478, (MTV007.25), len: 241 aa. Possible invasion protein. Possibly exported protein, nearly identical to AF0060|AF006054_2 hypothetical invasion protein INV2 of Mycobacterium tuberculosis (240 aa), FASTA scores: opt: 1509, E(): 0, (95.0% identity in 241 aa overlap); very similar to AF0021|AF002133_5 hypothetical invasion protein INV2 from Mycobacterium avium (244 aa), FASTA scores: opt: 1269, E():0, (78.0% identity in 246 aa overlap). Also similar to Mycobacterium tuberculosis protein MTCY336.37 and weakly similar to C-terminal segment of p60 proteins of Listeria spp.e.g. Q01836|P60_LISIN protein P60 precursor (481 aa), FASTA scores: opt: 241, E():4e-07, (37.7% identity in 122 aa overlap). Highly similar to C-terminal domain of preceeding ORF Rv1477|MTV007.24 (472 aa), FASTA scores: opt: 864, E(): 0, (60.1% identity in 213 aa overlap). Predicted to be an outer membrane protein (See Song et al., 2008).
Functional category-
ProteomicsIdentified in the cell wall fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS16684191669144+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1478|Rv1478
MRHTRFHPIKLAWITAVVAGLMVGVATPADAEPGQWDPTLPALVSAGAPGDPLAVANASLQATAQATQTTLDLGRQFLGGLGINLGGPAASAPSAATTGASRIPRANARQAVEYVIRRAGSQMGVPYSWGGGSLQGPSKGVDSGANTVGFDCSGLVRYAFAGVGVLIPRFSGDQYNAGRHVPPAEAKRGDLIFYGPGGGQHVTLYLGNGQMLEASGSAGKVTVSPVRKAGMTPFVTRIIEY