Gene Mb1514
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible invasion protein |
| Comments | Mb1514, -, len: 241 aa. Equivalent to Rv1478, len: 241 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 241 aa overlap). Hypothetical Invasion protein. Possibly exported protein, nearly identical to AF0060|AF006054_2 hypothetical invasion protein INV2 of M. tuberculosis (240 aa), FASTA scores: opt: 1509, E(): 0,(95.0% identity in 241 aa overlap); very similar to AF0021|AF002133_5 hypothetical invasion protein INV2 from Mycobacterium avium (244 aa), FASTA scores: opt: 1269,E():0, (78.0% identity in 246 aa overlap). Also similar to Mycobacterium tuberculosis protein MTCY336.37 and weakly similar to C-terminal segment of p60 proteins of Listeria spp.e.g. Q01836|P60_LISIN PROTEIN P60 PRECURSOR (481 aa),FASTA scores: opt: 241, E():4e-07, (37.7% identity in 122 aa overlap). Highly similar to C-terminal domain of preceeding ORF Rv1477|MTV007.24 (472 aa), FASTA scores: opt: 864, E(): 0, (60.1% identity in 213 aa overlap). |
| Functional category | Virulence, detoxification, adaptation |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1665165 | 1665890 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1514|Mb1514
MRHTRFHPIKLAWITAVVAGLMVGVATPADAEPGQWDPTLPALVSAGAPGDPLAVANASLQATAQATQTTLDLGRQFLGGLGINLGGPAASAPSAATTGASRIPRANARQAVEYVIRRAGSQMGVPYSWGGGSLQGPSKGVDSGANTVGFDCSGLVRYAFAGVGVLIPRFSGDQYNAGRHVPPAEAKRGDLIFYGPGGGQHVTLYLGNGQMLEASGSAGKVTVSPVRKAGMTPFVTRIIEY
Bibliography
No article yet recorded
