Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in the fatty acid biosynthesis pathway (first reduction step) (mycolic acid biosynthesis); reduces KASA/KASB products [catalytic activity: (3R)-3-hydroxyacyl-[acyl-carrier protein] + NADP+ = 3-oxoacyl-[acyl-carrier protein] + NADPH].
Product3-oxoacyl-[acyl-carrier protein] reductase FabG1 (3-ketoacyl-acyl carrier protein reductase) (mycolic acid biosynthesis a protein)
CommentsRv1483, (MTCY277.04), len: 247 aa. FabG1 (alternate gene name: mabA), 3-oxoacyl-[acyl-carrier protein] reductase (see citations below), equivalent to O07399|FABG_MYCAV 3-oxoacyl-[acyl-carrier protein] reductase from Mycobacterium avium (255 aa); P71534|FABG_MYCSM 3-oxoacyl-[acyl-carrier protein] reductase from Mycobacterium smegmatis (255 aa); and NP_302228.1|NC_002677 3-oxoacyl-[ACP] reductase (aka MabA) from Mycobacterium leprae (253 aa). Also highly similar to many e.g. T36779 probable 3-oxacyl-(acyl-carrier-protein) reductase from Streptomyces coelicolor (234 aa); FABG_ECOLI|P25716|NP_415611.1|NC_000913 3-oxoacyl-[acyl-carrier-protein] reductase from Escherichia coli strain K12 (244 aa), FASTA scores: opt: 664, E(): 6.8e-35, (44.4% identity in 241 aa overlap); etc. Contains PS00061 Short-chain dehydrogenases/reductases family signature. Belongs to the short-chain dehydrogenases/reductases (SDR) family.
Functional categoryLipid metabolism
ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See de Souza et al., 2011) (See Kelkar et al., 2011).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Required for survival in primary murine macrophages, by transposon site hybridization (TraSH) in H37Rv (See Rengarajan et al., 2005). Essential gene, determined by allelic exchange experiments (See Parish et al., 2007). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS16734401674183+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1483|fabG1
VTATATEGAKPPFVSRSVLVTGGNRGIGLAIAQRLAADGHKVAVTHRGSGAPKGLFGVECDVTDSDAVDRAFTAVEEHQGPVEVLVSNAGLSADAFLMRMTEEKFEKVINANLTGAFRVAQRASRSMQRNKFGRMIFIGSVSGSWGIGNQANYAASKAGVIGMARSIARELSKANVTANVVAPGYIDTDMTRALDERIQQGALQFIPAKRVGTPAEVAGVVSFLASEDASYISGAVIPVDGGMGMGH
      
Bibliography