Gene Rv1487
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Conserved membrane protein |
| Comments | Rv1487, (MTCY277.08), len: 144 aa. Conserved membrane protein. Highly similar to O07404|AF002133 MAV145 from Mycobacterium avium (145 aa), FASTA scores: opt: 667, E(): 0, (72.5% identity in 142 aa overlap). Also similar to AL079332|SCI5.05 hypothetical protein from Streptomyces coelicolor (143 aa), FASTA scores: opt: 344, E(): 1.3e-15, (44.8% identity in 134 aa overlap). |
| Functional category | Cell wall and cell processes |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1676941 | 1677375 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1487|Rv1487
MPVALIWLIAALVLVGAEALTGDMFLLMLGGGALAASVSSWLLAWPMWADGAVFLLVSVLLLVLVRPAVRRRLTQTKGVQLGIEALEGKKAVVLGRVARDGGQVKLDGQVWTARPLNDGDVFEPGDSVTVVQIDGATAVVFKDV
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant