Gene Rv1489A
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved protein |
| Comments | Rv1489A, len: 76 aa. Conserved protein, similar to part of alpha subunit of many methylmalonyl-CoA mutases (~750 aa). Size difference suggests possible gene fragment although Mycobacterium tuberculosis has intact methylmalonyl-CoA mutase gene. P71774|MUTB_MYCTU probable methylmalonyl-CoA mutase from Mycobacterium tuberculosis (750 aa), FASTA scores: opt: 258, E(): 3.2e-10, (73.35% identity in 60 aa overlap). ORF predicted by GC plot. |
| Functional category | Conserved hypotheticals |
| Mutant | Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1678942 | 1679172 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1489A|Rv1489A
VSVGEVEVLKVENSRVRAEQLAKLYELRSSRDRVRVDAALAELSRAAAARGCAGTSGLGNNLMAPGPPHSLLGRDR
Bibliography
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
