Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved hypothetical protein
CommentsRv1503c, (MTCY277.25c), len: 182 aa. Conserved hypothetical protein, similar to C-terminal region of P27833|RFFA_ECOLI lipopolysaccharide biosynthesis protein from Escherichia coli (376 aa), FASTA scores: opt: 565, E(): 0, (49.4% identity in 170 aa overlap); Rv1503c and Rv1504c are both similar to RFFA_ECOLI but are separated by a stop codon, sequence appears to be correct so possible pseudogene.
Functional categoryConserved hypotheticals
ProteomicsIdentified in the cell wall and cell membrane fractions of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Found to be deleted (partially or completely) in one or more clinical isolates (See Tsolaki et al., 2004).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS16939961694544-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1503c|Rv1503c
DFLLRAEILREKGTNRSRFLRNEVDKYTWQDKGSSYLPSELVAAFLWAQFEEAERITRIRLDLWNRYHESFESLEQRGLLRRPIIPQGCSHNAHMYYVLLAPSADREEVLARLTSEGIGAVFHYVPLHDSPAGRRYGRTNGNLTVTNDVASRLIRLPMWVGLQEVDQSRVVEALTRILTLRA