Gene Rv1508A
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv1508A, len: 120 aa. Conserved hypothetical protein, highly similar to central part of glycosyl transferases from various mycobacteria and eubacteria e.g. P71790|MTCY277.33|Rv1511 Hypothetical protein from M. tuberculosis (340 aa), FASTA scores: opt: 210, E(): 2.5 e-09, (42.9% identity in 105 aa overlap). |
| Functional category | Conserved hypotheticals |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1699866 | 1700228 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1508A|Rv1508A
VKRALITGITGPDGSYLAKLPLKGYVAAGSPAEVYFCWATRNYRELYGLLAVNSIWFNHESPRHGETFMTRNPAPYRGRQRGADRCADADAPAHPDRYQYWGVPASVRGVIDRAMGVCVE
Bibliography
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
