Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown, probably involved in nucleotide-sugar metabolism
ProductGDP-D-mannose dehydratase GmdA (GDP-mannose 4,6 dehydratase) (GMD)
CommentsRv1511, (MTCY277.33), len: 340 aa. Probable gmdA, GDP-D-mannose dehydratase, equivalent to AF125999|AF125999_13 Mycobacterium avium enzyme (343 aa), FASTA scores: opt: 2085, E(): 0, (89.1% identity in 338 aa overlap); similar to G755218 pseudomonas aeruginosa GDP-D-mannose dehydratase (GCA) (323 aa), FASTA scores: opt: 1073, E(): 0, (51.9% identity in 320 aa overlap); and to S74433 GDP-D-mannose dehydratase rfbD - Syn (362 aa), FASTA scores: opt: 1405, E(): 0, (63.9% identity in 327 aa overlap).
Functional categoryIntermediary metabolism and respiration
ProteomicsThe product of this CDS corresponds to spot 2_25 identified by proteomics at the Max Planck Institute for Infection Biology, Berlin, Germany (See Mattow et al., 2001). Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the culture filtrate, membrane protein fraction, and whole cell lysates of M. tuberculosis H37Rv (See de Souza et al., 2011).
TranscriptomicsRT-PCR shows increased expression in M. tuberculosis H37Rv grown in anaerobic non-replicating conditions (See Saxena et al., 2008).
MutantNon-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in CDC1551 strain (see Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS17030741704096+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1511|gmdA
VKRALITGITGQDGSYLAELLLAKGYEVHGLIRRASTFNTSRIDHLYVDPHQPGARLFLHYGDLIDGTRLVTLLSTIEPDEVYNLAAQSHVRVSFDEPVHTGDTTGMGSMRLLEAVRLSRVHCRFYQASSSEMFGASPPPQNELTPFYPRSPYGAAKVYSYWATRNYREAYGLFAVNGILFNHESPRRGETFVTRKITRAVARIKAGIQSEVYMGNLDAVRDWGYAPEYVEGMWRMLQTDEPDDFVLATGRGFTVREFARAAFEHAGLDWQQYVKFDQRYLRPTEVDSLIGDATKAAELLGWRASVHTDELARIMVDADMAALECEGKPWIDKPMIAGRT