Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved protein
CommentsRv1513, (MTCY277.35), len: 243 aa. Conserved protein, similar to hypothetical proteins from several organisms e.g. AJ223833|MAP223833_3 from Mycobacterium avium paratuberculosis (240 aa), FASTA scores: opt: 1053 E(): 0, (66.3% identity in 243 aa overlap); P74191|SLL1173 from Synechocystis (244 aa), FASTA scores: opt: 276, E(): 1.1e-07, (32.2 % identity in 202 aa overlap). Also highly similar to P95136|Q50460|MTCY349.33c|Rv2956 from Mycobacterium tuberculosis (243 aa), (70.0% identity in 237 aa overlap).
Functional categoryConserved hypotheticals
ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS (See Xiong et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS17050581705789+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1513|Rv1513
MRLARRARNILRRNGIEVSRYFAELDWERNFLRQLQSHRVSAVLDVGANSGQYARGLRGAGFAGRIVSFEPLPGPFAVLQRSASTDPLWECRRCALGDVDGTISINVAGNEGASSSVLPMLKRHQDAFPPANYVGAQRVPIHRLDSVAADVLRPNDIAFLKIDVQGFEKQVIAGGDSTVHDRCVGMQLELSFQPLYEGGMLIREALDLVDSLGFTLSGLQPGFTDPRNGRMLQADGIFFRGSD