Gene Rv1513
in Mycobacterium tuberculosis H37Rv
General annotation
Type | CDS |
Function | Function unknown |
Product | Conserved protein |
Comments | Rv1513, (MTCY277.35), len: 243 aa. Conserved protein, similar to hypothetical proteins from several organisms e.g. AJ223833|MAP223833_3 from Mycobacterium avium paratuberculosis (240 aa), FASTA scores: opt: 1053 E(): 0, (66.3% identity in 243 aa overlap); P74191|SLL1173 from Synechocystis (244 aa), FASTA scores: opt: 276, E(): 1.1e-07, (32.2 % identity in 202 aa overlap). Also highly similar to P95136|Q50460|MTCY349.33c|Rv2956 from Mycobacterium tuberculosis (243 aa), (70.0% identity in 237 aa overlap). |
Functional category | Conserved hypotheticals |
Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS (See Xiong et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 1705058 | 1705789 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1513|Rv1513 MRLARRARNILRRNGIEVSRYFAELDWERNFLRQLQSHRVSAVLDVGANSGQYARGLRGAGFAGRIVSFEPLPGPFAVLQRSASTDPLWECRRCALGDVDGTISINVAGNEGASSSVLPMLKRHQDAFPPANYVGAQRVPIHRLDSVAADVLRPNDIAFLKIDVQGFEKQVIAGGDSTVHDRCVGMQLELSFQPLYEGGMLIREALDLVDSLGFTLSGLQPGFTDPRNGRMLQADGIFFRGSD
Bibliography
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Xiong Y, Chalmers MJ, Gao FP, Cross TA and Marshall AG [2005]. Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. Proteomics
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant