Gene Rv1517
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Conserved hypothetical transmembrane protein |
| Comments | Rv1517, (MTCY277.39), len: 254 aa. Conserved hypothetical transmembrane protein, similar to G466802|LEPB1170_F2_64 from Mycobacterium leprae (230 aa), FASTA scores: opt: 282, E(): 2.2e-11, (34.1% identity in 255 aa overlap). Also similar to Mycobacterium tuberculosis Rv3821|MTCY409.09c (237 aa) (36.3% identity in 256 aa overlap); and Rv3481c. |
| Functional category | Cell wall and cell processes |
| Transcriptomics | DNA microarrays show lower level of expression in M. tuberculosis H37Rv than in phoP|Rv0757 mutant (See Walters et al., 2006). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1708871 | 1709635 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1517|Rv1517
MWTMVLLLGLGMAIDPARLGLAVVMLSRRRPMLNLFAFWVGGMVAGVGIALAVLVFMRDVALAAIQGVVSAANEFREAVGILAGGRLHIVIGVIMLLLAARMVARARAQVGVPVGPVGVADGGMSALALAQRPPGLVARLEVRTQQMLQGDVVWPAFVVGVASSAPPFESVVALTVIMASGAEIGTQLGAFVVFTLLVLAVIEIPLVAYLAIPQQTQQVMLRFQDWVRSNRRQISLTILIGVGFLFLYQGVTSL
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Walters SB et al. [2006]. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Transcriptome
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
