Gene Rv1571
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved protein |
| Comments | Rv1571, (MTCY336.32c), len: 169 aa. Conserved protein, similar at N-terminal region to Q49625|LEPB1170_C3_227 hypothetical protein from Mycobacterium leprae (104 aa), FASTA results: opt: 473, E(): 3.9e-24, (74.5% identity in 102 aa overlap). Identical to O06619|AF041819|AF041819_6 Mycobacterium bovis BCG (169 aa). |
| Functional category | Conserved hypotheticals |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). <EXISTING> Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1778539 | 1779048 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1571|Rv1571
MVHSIELVFDSDTEAAIRRIWAGLAAAGIPSQAPASRPHVSLAVAERIAPEVDEPLGAVARRLPLDCVIGAPVLFGRANVVFTRLVVPTSELLALHAEVHRLCGPHLAPAPMANSLPGQWTAHVTLARRVGGHQLGRALRIAGRPSRIDGRFAGLRRWDGNTRAEYLLG
Bibliography
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
