Gene Mb1598
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb1598, -, len: 169 aa. Equivalent to Rv1571, len: 169 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 169 aa overlap). Conserved hypothetical protein, similar at N-terminal region to Q49625|LEPB1170_C3_227 hypothetical protein from Mycobacterium leprae (104 aa), FASTA results: opt: 473,E(): 3.9e-24, (74.5% identity in 102 aa overlap). Identical to O06619|AF041819|AF041819_6 Mycobacterium bovis BCG (169 aa). |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1763905 | 1764414 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1598|Mb1598
MVHSIELVFDSDTEAAIRRIWAGLAAAGIPSQAPASRPHVSLAVAERIAPEVDEPLGAVARRLPLDCVIGAPVLFGRANVVFTRLVVPTSELLALHAEVHRLCGPHLAPAPMANSLPGQWTAHVTLARRVGGHQLGRALRIAGRPSRIDGRFAGLRRWDGNTRAEYLLG
Bibliography
No article yet recorded