Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductPartial REP13E12 repeat protein
CommentsRv1588c, (MTCY336.16), len: 222 aa. Partial REP13E12 repeat protein (see citation below), nearly identical to ORF's in other Rep13E12 repeats, including Rv0095c|MTCY251.14c|Y05E_MYCTU|Q10891 hypothetical 15.4 kd protein cy251.14 from Mycobacterium tuberculosis (136 aa), FASTA results: opt: 613, E(): 9.9e-29, (86.5% identity in 111 aa overlap). This region is a possible MT-complex-specific genomic island (See Becq et al., 2007).
Functional categoryInsertion seqs and phages
ProteomicsIdentified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005).
MutantNon-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS17891681789836-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1588c|Rv1588c
MLANSREELVEVFDALDAELDRLDEVSFEVLTTPERLRSLERLECLVRRLPAVGHALINQLDAQASEEELGGTLCCALANRLRITKPDAARRIADAADLGPRRALTGEPLAPQLTATATAQRQGLIGEAHVKVIRALFRPPARRGGCVHPPGRRSRPGRQSRSISSRRAGPLRPAGHGLATPRRRPHRHRTRPQTRHHPEQPAIRRHVTAKWLPDPPSAGHL