Gene Rv1588c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Partial REP13E12 repeat protein |
| Comments | Rv1588c, (MTCY336.16), len: 222 aa. Partial REP13E12 repeat protein (see citation below), nearly identical to ORF's in other Rep13E12 repeats, including Rv0095c|MTCY251.14c|Y05E_MYCTU|Q10891 hypothetical 15.4 kd protein cy251.14 from Mycobacterium tuberculosis (136 aa), FASTA results: opt: 613, E(): 9.9e-29, (86.5% identity in 111 aa overlap). This region is a possible MT-complex-specific genomic island (See Becq et al., 2007). |
| Functional category | Insertion seqs and phages |
| Proteomics | Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1789168 | 1789836 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1588c|Rv1588c
MLANSREELVEVFDALDAELDRLDEVSFEVLTTPERLRSLERLECLVRRLPAVGHALINQLDAQASEEELGGTLCCALANRLRITKPDAARRIADAADLGPRRALTGEPLAPQLTATATAQRQGLIGEAHVKVIRALFRPPARRGGCVHPPGRRSRPGRQSRSISSRRAGPLRPAGHGLATPRRRPHRHRTRPQTRHHPEQPAIRRHVTAKWLPDPPSAGHL
Bibliography
- Gordon SV et al. [1999]. New insertion sequences and a novel repeated sequence in the genome of Mycobacterium tuberculosis H37Rv. Sequence
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Becq J, Gutierrez MC, Rosas-Magallanes V, Rauzier J, Gicquel B, Neyrolles O and Deschavanne P [2007]. Contribution of horizontally acquired genomic islands to the evolution of the tubercle bacilli. Sequence
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
