Gene Mb1614c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Partial REP13E12 repeat protein |
| Comments | Mb1614c, -, len: 222 aa. Equivalent to Rv1588c,len: 222 aa, from Mycobacterium tuberculosis strain H37Rv,(98.2% identity in 222 aa overlap). Partial REP13E12 repeat protein (see citation below), nearly identical to ORF's in other Rep13E12 repeats, including Rv0095c|MTCY251.14c|Y05E_MYCTU|Q10891 hypothetical 15.4 kd protein cy251.14 from Mycobacterium tuberculosis (136 aa),FASTA results: opt: 613, E(): 9.9e-29, (86.5% identity in 111 aa overlap). |
| Functional category | Insertion seqs and phages |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1774534 | 1775202 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1614c|Mb1614c
MLANSREELVEVFDALDAELDRLDEVSFEVLTTPERLRSLERLECLVRRLPAVGHTLINQLDTQASEEELGGTLCCALANRLRITKPDAALRIADAADLGPRRALTGEPLAPQLTATATAQRQGLIGEAHIKVIRALFRPPARRGGCVHPPGRRSRPGRQSRSISSRRAGPLRPAGHGLATPRRRPHRHRTRPQTRHHPEQPAIRRHVTAKWLPDPPSAGHL
Bibliography
No article yet recorded