Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved hypothetical protein
CommentsRv1592c, (MTCY336.12), len: 446 aa. Conserved hypothetical protein, some similarity to Q49629|B1170_F1_46 from Mycobacterium leprae (132 aa), FASTA results: opt: 332, E(): 4.5e-14, (56.3% identity in 87 aa overlap). Nearly identical to truncated Mycobacterium bovis BCG protein (148 aa) AF041819|AF041819_11.
Functional categoryConserved hypotheticals
TranscriptomicsmRNA identified by DNA microarray analysis (gene induced by hypoxia or by isoniazid (INH) or ethionamide treatment: see citations below). DNA microarrays show higher level of expression in M. tuberculosis H37Rv than in Rv3676 mutant (See Rickman et al., 2005).
MutantNon-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Slow growth mutant by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al.,2003). Non essential gene by Himar1 transposon mutagenesis in CDC1551 strain (see Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS17924001793740-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1592c|Rv1592c
MVEPGNLAGATGAEWIGRPPHEELQRKVRPLLPSDDPFYFPPAGYQHAVPGTVLRSRDVELAFMGLIPQPVTATQLLYRTTNMYGNPEATVTTVIVPAELAPGQTCPLLSYQCAIDAMSSRCFPSYALRRRAKALGSLTQMELLMISAALAEGWAVSVPDHEGPKGLWGSPYEPGYRVLDGIRAALNSERVGLSPATPIGLWGYSGGGLASAWAAEACGEYAPDLDIVGAVLGSPVGDLGHTFRRLNGTLLAGLPALVVAALQHSYPGLARVIKEHANDEGRQLLEQLTEMTTVDAVIRMAGRDMGDFLDEPLEDILSTPEISHVFGDTKLGSAVPTPPVLIVQAVHDYLIDVSDIDALADSYTAGGANVTYHRDLFSEHVSLHPLSAPMTLRWLTDRFAGKPLTDHRVRTTWPTIFNPMTYAGMARLAVIAAKVITGRKLSRRPL