Gene Rv1592c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv1592c, (MTCY336.12), len: 446 aa. Conserved hypothetical protein, some similarity to Q49629|B1170_F1_46 from Mycobacterium leprae (132 aa), FASTA results: opt: 332, E(): 4.5e-14, (56.3% identity in 87 aa overlap). Nearly identical to truncated Mycobacterium bovis BCG protein (148 aa) AF041819|AF041819_11. |
| Functional category | Conserved hypotheticals |
| Transcriptomics | mRNA identified by DNA microarray analysis (gene induced by hypoxia or by isoniazid (INH) or ethionamide treatment: see citations below). DNA microarrays show higher level of expression in M. tuberculosis H37Rv than in Rv3676 mutant (See Rickman et al., 2005). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Slow growth mutant by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al.,2003). Non essential gene by Himar1 transposon mutagenesis in CDC1551 strain (see Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1792400 | 1793740 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1592c|Rv1592c
MVEPGNLAGATGAEWIGRPPHEELQRKVRPLLPSDDPFYFPPAGYQHAVPGTVLRSRDVELAFMGLIPQPVTATQLLYRTTNMYGNPEATVTTVIVPAELAPGQTCPLLSYQCAIDAMSSRCFPSYALRRRAKALGSLTQMELLMISAALAEGWAVSVPDHEGPKGLWGSPYEPGYRVLDGIRAALNSERVGLSPATPIGLWGYSGGGLASAWAAEACGEYAPDLDIVGAVLGSPVGDLGHTFRRLNGTLLAGLPALVVAALQHSYPGLARVIKEHANDEGRQLLEQLTEMTTVDAVIRMAGRDMGDFLDEPLEDILSTPEISHVFGDTKLGSAVPTPPVLIVQAVHDYLIDVSDIDALADSYTAGGANVTYHRDLFSEHVSLHPLSAPMTLRWLTDRFAGKPLTDHRVRTTWPTIFNPMTYAGMARLAVIAAKVITGRKLSRRPL
Bibliography
- Wilson M, DeRisi J, Kristensen HH, Imboden P, Rane S, Brown PO and Schoolnik GK [1999]. Exploring drug-induced alterations in gene expression in Mycobacterium tuberculosis by microarray hybridization. Regulation
- Sherman DR, Voskuil M, Schnappinger D, Liao R, Harrell MI and Schoolnik GK [2001]. Regulation of the Mycobacterium tuberculosis hypoxic response gene encoding alpha -crystallin. Transcriptome
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Rickman L, Scott C, Hunt DM, Hutchinson T, Menendez MC, Whalan R, Hinds J, Colston MJ, Green J and Buxton RS [2005]. A member of the cAMP receptor protein family of transcription regulators in Mycobacterium tuberculosis is required for virulence in mice and controls transcription of the rpfA gene coding for a resuscitation promoting factor. Transcriptome
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant