Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in inositol phosphate metabolism. It is responsible for the provision of inositol required for synthesis of phosphatidylinositol and polyphosphoinositides. Key enzyme of the phosphatidyl inositol signaling pathway [catalytic activity: inositol 1(or 4)-monophosphate + H(2)O = inositol + orthophosphate].
ProductProbable inositol-monophosphatase ImpA (imp)
CommentsRv1604, (MTV046.02), len: 270 aa. Probable impA, inositol monophosphatase, similar to many e.g. AF0059|AF005905_2 inositol monophosphate phosphatase from Mycobacterium smegmatis (276 aa), FASTA scores: opt: 1241, E(): 0, (70.5% identity in 261 aa overlap). Also similar to Mycobacterium tuberculosis proteins Rv3137 and Rv2701c.
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Colony morphology of M. tuberculosis H37Rv impA|Rv1604 deletion mutant is not different from wild-type; phosphatidylinositol mannosides (PIMs; by TLC) and mycothiol levels (by HPLC) are normal in the mutant (See Movahedzadeh et al., 2010).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS18040391804851+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1604|impA
MHLDSLVAPLVEQASAILDAATALFLVGHRADSAVRKKGNDFATEVDLAIERQVVAALVAATGIEVHGEEFGGPAVDSRWVWVLDPIDGTINYAAGSPLAAILLGLLHDGVPVAGLTWMPFTDPRYTAVAGGPLIKNGVPQPPLADAELANVLVGVGTFSADSRGQFPGRYRLAVLEKLSRVSSRLRMHGSTGIDLVFVADGILGGAISFGGHVWDHAAGVALVRAAGGVVTDLAGQPWTPASRSALAGPPRVHAQILEILGSIGEPEDY