Gene Rv1646
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | PE family protein PE17 |
| Comments | Rv1646, (MTCY06H11.11), len: 310 aa. PE17, Member of the Mycobacterium tuberculosis PE family of proteins (see citation below), similar to many e.g. YW36_MYCTU|Q10873 hypothetical 53.7 kd protein cy39.36c (558 aa), FASTA scores, opt: 411, E(): 1.3e-15, (34.4% identity in 320 aa overlap). |
| Functional category | Pe/ppe |
| Proteomics | Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1855764 | 1856696 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1646|PE17
MSFLTVAPDMVTAAAGNLESVGSALNEAAAAAAPATVGLAAPAADRVSAVVAAMLGAYARDFQGISAQIAGFHNQFVGALRGGAAAYASAEAANVQQTVVNAVNAPAQALLGHPLIGPETVGSSAAAVSFGFGPLLLAGSDPLLAVPFSYPASLPTPFGPVTMTLNGSFDPLTQQVVFDSGSLTAPAPFVYGLGAVGPALTTMTALQNSGTAFSGAVQSGNLLGAAGALLQAPGNAVTGFLFGQTAISQSIPGPSNLGYESVGISVPVGGLLAPLQPVTVTLTPTSGMPTAIQLSGTQFGGLLPALLNGF
Bibliography
- Brennan MJ et al. [2002]. The PE multigene family: a 'molecular mantra' for mycobacteria. Review
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant