Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductPE family protein PE17
CommentsRv1646, (MTCY06H11.11), len: 310 aa. PE17, Member of the Mycobacterium tuberculosis PE family of proteins (see citation below), similar to many e.g. YW36_MYCTU|Q10873 hypothetical 53.7 kd protein cy39.36c (558 aa), FASTA scores, opt: 411, E(): 1.3e-15, (34.4% identity in 320 aa overlap).
Functional categoryPe/ppe
ProteomicsIdentified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS18557641856696+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1646|PE17
MSFLTVAPDMVTAAAGNLESVGSALNEAAAAAAPATVGLAAPAADRVSAVVAAMLGAYARDFQGISAQIAGFHNQFVGALRGGAAAYASAEAANVQQTVVNAVNAPAQALLGHPLIGPETVGSSAAAVSFGFGPLLLAGSDPLLAVPFSYPASLPTPFGPVTMTLNGSFDPLTQQVVFDSGSLTAPAPFVYGLGAVGPALTTMTALQNSGTAFSGAVQSGNLLGAAGALLQAPGNAVTGFLFGQTAISQSIPGPSNLGYESVGISVPVGGLLAPLQPVTVTLTPTSGMPTAIQLSGTQFGGLLPALLNGF