Gene Rv1670
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv1670, (MTV047.05), len: 115 aa. Conserved hypothetical protein, highly similar to D90908|D90908_87 Hypothetical protein of Synechocystis sp. PCC6803 complete (94 aa), FASTA scores opt: 378, E(): 3.5e-2, (55.2% identity in 96 aa overlap); also shows some similarity to Mycobacterium tuberculosis hypothetical proteins e.g. C-terminal region of O53404|Rv1056 (254 aa), and P96817|Rv0140 (126 aa). |
| Functional category | Conserved hypotheticals |
| Proteomics | Translational start site supported by proteomics data (See Kelkar et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1896120 | 1896467 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1670|Rv1670
MIRAVWNGTVLAEAPRTVRVEGNHYFPPESLHREHLIESPTTSICPWKGLAHYYNVVVDGPYGPVNPDAAWYYRRPSPLARRIKNHVAFWHGVTVEGESESRHGLARRVVAWLGK
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
