Gene Mb1697
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | CONSERVED HYPOTHETICAL PROTEIN |
| Comments | Mb1697, -, len: 115 aa. Equivalent to Rv1670, len: 115 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 115 aa overlap). Conserved hypothetical protein, highly similar to D90908|D90908_87 Hypothetical protein of Synechocystis sp. PCC6803 complete (94 aa),FASTA scores opt: 378, E(): 3.5e-2, (55.2% identity in 96 aa overlap); also shows some similarity to M.tuberculosis hypothetical proteins e.g. C-terminal region of O53404|Rv1056 (254 aa), and P96817|Rv0140 (126 aa). |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1881516 | 1881863 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1697|Mb1697
MIRAVWNGTVLAEAPRTVRVEGNHYFPPESLHREHLIESPTTSICPWKGLAHYYNVVVDGPYGPVNPDAAWYYRRPSPLARRIKNHVAFWHGVTVEGESESRHGLARRVVAWLGK
Bibliography
No article yet recorded