Gene Rv1677
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown; possibly involved in thiol:disulfide interchange. |
| Product | Probable conserved lipoprotein DsbF |
| Comments | Rv1677, (MTV047.12), len: 182 aa. Probable dsbF, conserved lipoprotein possibly involved in thiol:disulfide interchange. Highly similar to C-terminus of Z74024|MTCY274.09 mpt53 soluble secreted antigen precursor from Mycobacterium tuberculosis (173 aa), FASTA scores: opt: 482, E(): 3.6e-23, (52.8% identity in 142 aa overlap) . Also some similarity to P52237|TIPB_PSEFL thiol:disulfide interchange protein TIPB precursor from Pseudomonas fluorescens (178 aa), FASTA scores: opt: 190, E(): 4.4e-05, (28.5% identity in 151 aa overlap); and P33926|DSBE_ECOLI thiol:disulfide interchange protein from Escherichia coli (185 aa), FASTA scores: opt: 194, E(): 2.6e-05, (29.1% identity in 175 aa overlap). Contains PS00013 Prokaryotic membrane lipoprotein lipid attachment site and PS00194 Thioredoxin family active site. Nucleotide position 1901816 in the genome sequence has been corrected, A:G resulting in Q23Q. |
| Functional category | Cell wall and cell processes |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1901748 | 1902296 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1677|dsbF
VTHSRLIGALTVVAIIVTACGSQPKSQPAVAPTGDAAAATQVPAGQTVPAQLQFSAKTLDGHDFHGESLLGKPAVLWFWAPWCPTCQGEAPVVGQVAASHPEVTFVGVAGLDQVPAMQEFVNKYPVKTFTQLADTDGSVWANFGVTQQPAYAFVDPHGNVDVVRGRMSQDELTRRVTALTSR
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Niemann S, Koser CU, Gagneux S, Plinke C, Homolka S, Bignell H, Carter RJ, Cheetham RK, Cox A, Gormley NA, Kokko-Gonzales P, Murray LJ, Rigatti R, Smith VP, Arends FP, Cox HS, Smith G and Archer JA [2009]. Genomic diversity among drug sensitive and multidrug resistant isolates of Mycobacterium tuberculosis with identical DNA fingerprints. Sequence
- Ioerger TR et al. [2010]. Variation among genome sequences of H37Rv strains of Mycobacterium tuberculosis from multiple laboratories. Sequence
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant