Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown; possibly involved in thiol:disulfide interchange.
ProductProbable conserved lipoprotein DsbF
CommentsRv1677, (MTV047.12), len: 182 aa. Probable dsbF, conserved lipoprotein possibly involved in thiol:disulfide interchange. Highly similar to C-terminus of Z74024|MTCY274.09 mpt53 soluble secreted antigen precursor from Mycobacterium tuberculosis (173 aa), FASTA scores: opt: 482, E(): 3.6e-23, (52.8% identity in 142 aa overlap) . Also some similarity to P52237|TIPB_PSEFL thiol:disulfide interchange protein TIPB precursor from Pseudomonas fluorescens (178 aa), FASTA scores: opt: 190, E(): 4.4e-05, (28.5% identity in 151 aa overlap); and P33926|DSBE_ECOLI thiol:disulfide interchange protein from Escherichia coli (185 aa), FASTA scores: opt: 194, E(): 2.6e-05, (29.1% identity in 175 aa overlap). Contains PS00013 Prokaryotic membrane lipoprotein lipid attachment site and PS00194 Thioredoxin family active site. Nucleotide position 1901816 in the genome sequence has been corrected, A:G resulting in Q23Q.
Functional categoryCell wall and cell processes
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS19017481902296+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1677|dsbF
VTHSRLIGALTVVAIIVTACGSQPKSQPAVAPTGDAAAATQVPAGQTVPAQLQFSAKTLDGHDFHGESLLGKPAVLWFWAPWCPTCQGEAPVVGQVAASHPEVTFVGVAGLDQVPAMQEFVNKYPVKTFTQLADTDGSVWANFGVTQQPAYAFVDPHGNVDVVRGRMSQDELTRRVTALTSR