Gene Rv1685c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv1685c, (MTCI125.07c), len: 207 aa. Conserved hypothetical protein, some similarity to other Mycobacterium tuberculosis hypothetical regulatory proteins e.g. Q10774|Rv1556|YF56_MYCTU (202 aa), FASTA scores: opt: 111, E(): 1.7e-05, (24.1% identity in 195 aa overlap); and P95215|Rv0258c|MTCY06A4.02c (151 aa) FASTA scores: (32.9% identity in 140 aa overlap); also similar to Q9X8G9|SCE7.13C|AL049819 putative Streptomyces coelicolor transcriptional regulator (204 aa), FASTA scores: opt: 480, E(): 6.4e-25, (40.4% identity in 203 aa overlap). |
| Functional category | Conserved hypotheticals |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019).Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1910776 | 1911399 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1685c|Rv1685c
VAAPDNSRRRPGRPAGSSDTRERILSSARELFAHNGIDRTSIRAVAAKAGVDAALVHHYFGTKQQLFAAAIHIPIDPMVIIGPIREAPVEELGYKLPSLLLPIWDSELGAGLIATLRSLISGSDVGLARSFLEEVVTVELGSRVDNPPGTGKIRTQFVASQLMGVVMARYIVRIEPFASLPAEQIVQTIAPNLQRYLTGELPDDLAP
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
