Gene Rv1686c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Thought to be involved in active transport of undetermined substrate (possibly drug) across the membrane. Responsible for the translocation of the substrate across the membrane. |
| Product | Probable conserved integral membrane protein ABC transporter |
| Comments | Rv1686c, (MTCI125.08c), len: 226 aa. Probable conserved integral membrane protein ABC transporter (see citation below), similar to AL049819|SCE7.05 putative integral membrane protein from Streptomyces coelicolor (266 aa), FASTA sacores: opt: 661, E(): 0, (45.1% identity in 226 aa overlap); and Q53627|U43537 membrane protein involved in mithramycin resistance from streptomyces argillaceus (233 aa), FASTA scores: opt: 222, E(): 5.4e-10, (28.7% identity in 216 aa overlap). |
| Functional category | Cell wall and cell processes |
| Proteomics | Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1911401 | 1912081 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1686c|Rv1686c
MILLVPILIITLMYFMFENVPHRPGTPSGFNTACLVLLGLFPLFVMFVITAITMQRERASGTLERILTTPLRRLDLLAGYGTAFSIAAAAQATLACIVAFWFLGFDTAGSPVWVFAIAIVNAVLGVGLGLLCSAFARTEFQAVQFIPLVMVPQLLLAGIIVPRALMPTWLEWISNVMPASYALEALQQVGAHPELTGIAVRDVVVVLSFAVASLCLAAVTLRRRTS
Bibliography
- Braibant M et al. [2000]. The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. Review Secondary
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
