Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionThought to be involved in active transport of undetermined substrate (possibly drug) across the membrane. Responsible for the translocation of the substrate across the membrane.
ProductProbable conserved integral membrane protein ABC transporter
CommentsRv1686c, (MTCI125.08c), len: 226 aa. Probable conserved integral membrane protein ABC transporter (see citation below), similar to AL049819|SCE7.05 putative integral membrane protein from Streptomyces coelicolor (266 aa), FASTA sacores: opt: 661, E(): 0, (45.1% identity in 226 aa overlap); and Q53627|U43537 membrane protein involved in mithramycin resistance from streptomyces argillaceus (233 aa), FASTA scores: opt: 222, E(): 5.4e-10, (28.7% identity in 216 aa overlap).
Functional categoryCell wall and cell processes
ProteomicsIdentified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS19114011912081-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1686c|Rv1686c
MILLVPILIITLMYFMFENVPHRPGTPSGFNTACLVLLGLFPLFVMFVITAITMQRERASGTLERILTTPLRRLDLLAGYGTAFSIAAAAQATLACIVAFWFLGFDTAGSPVWVFAIAIVNAVLGVGLGLLCSAFARTEFQAVQFIPLVMVPQLLLAGIIVPRALMPTWLEWISNVMPASYALEALQQVGAHPELTGIAVRDVVVVLSFAVASLCLAAVTLRRRTS