Gene Rv1687c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Thought to be involved in active transport of undetermined substrate (possibly drug) across the membrane. Responsible for energy coupling to the transport system. |
| Product | Probable conserved ATP-binding protein ABC transporter |
| Comments | Rv1687c, (MTCI125.09c), len: 255 aa. Probable conserved ATP-binding protein ABC transporter (see citation below), similar to many ABC-type transporters e.g. P55476|NODI_RHISN nodulation ATP-binding protein I from Rhizobium sp. (343 aa), FASTA scores: opt: 479, E(): 3.7e-23, (34.6% identity in 243 aa overlap); etc. Also similar to many other Mycobacterium tuberculosis ABC-type transporters e.g. MTCY19H9.04 (34.5% identity in 238 aa overlap). Contains PS00211 ABC transporters family signature and PS00017 ATP/GTP-binding site motif A (P-loop). Belongs to the ATP-binding transport protein family (ABC transporters). Also contains PS00039 dead-box subfamily ATP-dependent helicases signature, though this may be spurious. |
| Functional category | Cell wall and cell processes |
| Proteomics | Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1912153 | 1912920 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1687c|Rv1687c
MMISSSDELLRDGADPAVIIDQLRVIRGKRLALQDVSVRVACGTITGLLGPSGSGKTTLIRCIVGSQIIASGSVSVLGQPAGSAELRHRVGYMPQDPTIYNDLRVIDNIRYFAELCGVDRQAADEVIEAVDLRDHRTARCANLSGGQRARVSLACALVGRPDLLVLDEPTIGLDPVLRVELWDRFTALARRGTTLLVSSHVMDEADRCGDLLLLRQGQLLAHTTPHRLRKETGCTSLEEAFLSIVRRTTTVPAAG
Bibliography
- Braibant M et al. [2000]. The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. Review Secondary
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant