Gene Rv1727
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv1727, (MTCY04C12.12), len: 189 aa. Conserved hypothetical protein, similar to Mycobacterium tuberculosis hypothetical proteins P72040|Rv3773c|MTCY13D12.07C (194 aa), FASTA scores: opt: 176, E(): 2.7e-08, (31.1% identity in 180 aa overlap); and O53801|Rv0738 (182 aa). |
| Functional category | Conserved hypotheticals |
| Proteomics | Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Operon | Rv1726 and Rv1727 are co-transcribed, by RT-PCR (See Arnvig and Young, 2009). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1953270 | 1953839 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1727|Rv1727
MDLYSNLVEAEQRLVALVSSIEADSYSSPTPCDRWDVRALLSHALASIDAFAAAVDGAPGPDMAQVFSGADIVGDDPLGATQRITRRSQAAWSTVRDLNAELSTFIGVMPAGQALAIITFSTVVHGWDLAVATGQAGELPEHLAEAAQQVAAELVPVLRPRGLFAHDVDLAGEATPTQRLVALTGRKPR
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Arnvig KB et al. [2009]. Identification of small RNAs in Mycobacterium tuberculosis. Operon
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
