Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductPE-PGRS family protein PE_PGRS31
CommentsRv1768, (MTCY28.34), len: 618 aa. PE_PGRS31, Member of the Mycobacterium tuberculosis PE family, PGRS subfamily of gly-rich proteins (see Brennan and Delogu, 2002), highly similar to Q50615 hypothetical 40.8 kDa protein (498 aa), FASTA scores: opt: 1703, E(): 0, (57.4% identity in 566 aa overlap).
Functional categoryPe/ppe
ProteomicsIdentified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 30 and 90 days (See Kruh et al., 2010).
MutantNon-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS20006142002470+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1768|PE_PGRS31
MSYLVVVPELVAAAATDLANIGSSISAANAAAAAPTTALVAAGGDEVSAAIAALFGAHARAYQALSAQAAMFHEQFVRALAAGGNSYAVAEAATAQSVQQDLLNLINAPTQALLGRPLIGNGANGLPGTGQNGGDGGILYGNGGNGGSGGVNQAGGNGGNAGLWGNGGSGGAGGNATTAGRNGFNGGAGGSGGLLWGNGGAGGAGGNGGPAPLVGGVGTTGGAGGNGGGAGLFYGFGGAGGNGGMGGVAPSTGPSMGILPAGGVGGPGGSGGASALAFGSGGVGGAGGLGGPTDGTVQGVGGFGGQGGNGGQSGLLFGNAGAGGAGAAGGAGTGDTESFGGHGGAGGDGGAVGLIGNGGAGGTGSPGAVVGGNGGVGGLGGAGSPGGLLYGTGGAGGNGGPGGDGGTGATVGFAGSGGFGGAGGIAQLFGTGGMGGSGGGIGAGTTTVVPPDVAPVGGTGGNGGRAGLLLGVGGMGGNGGATSVGGTLYAAGGNGGDGGLVWGNGGTGGSGGAGGAGSVGNGGAGGNAALLFGNGGAGGAGGAGGIGAGGAGGFGAVLFGNGGAGGSGAPGGIGAGGNGGNALLVGNGGNGGAGTGGAAGGAGGSGGLLFGQNGMPGP