Gene Rv1790
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | PPE family protein PPE27 |
| Comments | Rv1790, (MTV049.12), len: 350 aa. PPE27, Member of the Mycobacterium tuberculosis PPE family of glycine-rich protein, similar to Z74024|MTCY274.24 Mycobacterium tuberculosis cosmid (404 aa), FASTA scores: opt: 849, E(): 0, (50.0% identity in 406 aa overlap). |
| Functional category | Pe/ppe |
| Proteomics | Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 90 days but not 30 days (See Kruh et al., 2010). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2028425 | 2029477 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1790|PPE27
MDFGALPPEINSGRMYCGPGSGPMLAAAAAWDGVAVELGLAATGYASVIAELTGAPWVGAASLSMVAAATPYVAWLSQAAARAEQAGMQAAAAAAAYEAAFVMTVPPPVITANRVLVMTLIATNFFGQNSAAIAVAEAQYAEMWAQDAVAMYGYAAASASASRLIPFAAPPKTTNSAGVVAQAVASVSWPNPNDWWLVRLLGSITPTERTTIVRLLGQSYLATGMARFLTSIAQQLTFGPGGTTAGSGGAWYPTPQFAGLGAGPAVSASLARAEPVGRLSVPPSWAVAAPAFAEKPEAGTPMSVIGEASSCGQGGLLRGIPLARAGRRTGAFAHRYGFRHSVITRSPSAG
Bibliography
- Gey Van Pittius NC, Gamieldien J, Hide W, Brown GD, Siezen RJ and Beyers AD [2001]. The ESAT-6 gene cluster of Mycobacterium tuberculosis and other high G+C Gram-positive bacteria. Secondary
- Kruh NA et al. [2010]. Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
