Gene Rv1792 (TB11.0, QILSS) in Mycobacterium tuberculosis H37Rv
Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
Gene summary information
Gene nameesxM
Gene length297 bp
IdentifierRv1792
Location 2030347 bp
Protein summary information
Molecular mass10865.1 Da
Isoelectric point5.0228
Protein length98 amino acids
Orthologs
M. bovis AF2122-97Mb1820
M. tuberculosis 18bMT18B_2338
M. tuberculosis MTBC0mtbc0_001905
Interacting Drugs/Compounds
TDR TargetsLink
Precomputed results
BLASTReport
General annotation
TypeCDS
FunctionFunction unknown
ProductESAT-6 like protein EsxM
CommentsRv1792, (MTV049.14), len: 98 aa. EsxM, ESAT-6 like protein (see Gey Van Pittius et al., 2001), member of Mycobacterium tuberculosis QILSS family of proteins with Rv1038c, Rv1197, Rv3620c and Rv2347c. Has in-frame stop codon at 18074, no error could be found to account for this. Identical (apart from stop codon) to P96363|Rv1038c|MTCY10G2.11 putative ESAT-6 like protein 2 (98 aa), FASTA scores: opt: 389, E(): 5.8e-26, (100.0% identity in 58 aa overlap). Similar protein present in Mycobacterium leprae e.g. Q49946|MLCB1701.06C|AL049191 putative ESAT-6 like protein X (95 aa), FASTA scores: opt: 343, E(): 1.6e-17, (57.6% identity in 92 aa overlap). Seems to belong to the ESAT6 family.
Functional categoryCell wall and cell processes
ProteomicsThe product of this CDS could be spot TB11.0 identified in short term culture filtrate by proteomics at the Statens Serum Institute (Denmark) (see proteomics citations).
Mutantnon essential gene by Himar1-based transposon mutagenesis in CDC1551 strain (see Lamichhane et al., 2003)
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS20303472030643+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1792|esxM
MASRFMTDPHAMRDMAGRFEVHAQTVEDEARRMWASAQNISGAGWSGMAEATSLDTMT+MNQAFRNIVNMLHGVRDGLVRDANNYEQQEQASQQILSS
Bibliography