Gene Rv1792 (TB11.0, QILSS)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | ESAT-6 like protein EsxM |
| Comments | Rv1792, (MTV049.14), len: 98 aa. EsxM, ESAT-6 like protein (see Gey Van Pittius et al., 2001), member of Mycobacterium tuberculosis QILSS family of proteins with Rv1038c, Rv1197, Rv3620c and Rv2347c. Has in-frame stop codon at 18074, no error could be found to account for this. Identical (apart from stop codon) to P96363|Rv1038c|MTCY10G2.11 putative ESAT-6 like protein 2 (98 aa), FASTA scores: opt: 389, E(): 5.8e-26, (100.0% identity in 58 aa overlap). Similar protein present in Mycobacterium leprae e.g. Q49946|MLCB1701.06C|AL049191 putative ESAT-6 like protein X (95 aa), FASTA scores: opt: 343, E(): 1.6e-17, (57.6% identity in 92 aa overlap). Seems to belong to the ESAT6 family. |
| Functional category | Cell wall and cell processes |
| Proteomics | The product of this CDS could be spot TB11.0 identified in short term culture filtrate by proteomics at the Statens Serum Institute (Denmark) (see proteomics citations). |
| Mutant | non essential gene by Himar1-based transposon mutagenesis in CDC1551 strain (see Lamichhane et al., 2003) Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2030347 | 2030643 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1792|esxM
MASRFMTDPHAMRDMAGRFEVHAQTVEDEARRMWASAQNISGAGWSGMAEATSLDTMT+MNQAFRNIVNMLHGVRDGLVRDANNYEQQEQASQQILSS
Bibliography
- Rosenkrands I, Weldingh K, Jacobsen S, Hansen CV, Florio W, Gianetri I and Andersen P [2000]. Mapping and identification of Mycobacterium tuberculosis proteins by two-dimensional gel electrophoresis, microsequencing and immunodetection. Proteomics
- Rosenkrands I et al. [2000]. Towards the proteome of Mycobacterium tuberculosis. Proteomics
- Gey Van Pittius NC, Gamieldien J, Hide W, Brown GD, Siezen RJ and Beyers AD [2001]. The ESAT-6 gene cluster of Mycobacterium tuberculosis and other high G+C Gram-positive bacteria. Secondary Phylogeny
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- [2009]. Systematic genetic nomenclature for type VII secretion systems. Nomenclature
