Gene Mb1820
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | esat-6 like protein esxm |
| Comments | Mb1820, esxM, len: 98 aa. Equivalent to Rv1792,len: 98 aa, from Mycobacterium tuberculosis strain H37Rv,(98.0% identity in 98 aa overlap). esxM, conserved hypothetical protein, member of Mycobacterium tuberculosis QILSS familyof proteins, genes linked to those of ESAT-6 family. Has in-frame stop codon at 18074, no error could be found to account for this. Identical (apart from stop codon) to P96363|Rv1038c|MTCY10G2.11 PUTATIVE ESAT-6 LIKE PROTEIN 2 (98 aa), FASTA scores: opt: 389, E(): 5.8e-26,(100.0% identity in 58 aa overlap). Also identical to Rv1038c, Rv1197, and almost identical to Rv3620c and Rv2347c. Similar protein present in Mycobacterium leprae e.g. Q49946|MLCB1701.06C|AL049191 PUTATIVE ESAT-6 LIKE PROTEIN X (95 aa), FASTA scores: opt: 343, E(): 1.6e-17,(57.6% identity in 92 aa overlap). |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2020802 | 2021098 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb1820|esxM
MASRFMTDPHAMRDMAGRFEVHAQTVEDEARRMWASAQNISGAGWSGQAEATSLDTMTQMNQAFRNIVNMLHGVRDGLVRDANNYEQQEQASQQILSS
Bibliography
No article yet recorded
