Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionThought to be involved in cardiolipin biosynthesis; generates cardiolipin from phosphatidylglycerol and CDP-diacylglycerol [catalytic activity: may be: phosphatidylglycerol + phosphatidylglycerol -> cardiolipin + glycerol, or: CDP-diacylglycerol + glycerol 3-phosphate = CMP + 3-(3-phosphatidyl)-glycerol 1-phosphate].
ProductProbable CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase PgsA2 (PGP synthase) (phosphatidylglycerophosphate synthase) (3-phosphatidyl-1'-glycerol-3'phosphate synthase)
CommentsRv1822, (MTCY1A11.21c), len: 209 aa. Probable pgsA2, CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyl-transferase (see citation below), integral membrane protein, equivalent to AL008609|MLCB1788_17 phosphatidyltransferase from Mycobacterium leprae (206 aa), FASTA score: (76.6% identity in 205 aa overlap). Also highly similar or similar to others e.g. CAB88885.1|AL353861 putative CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyl-transferase from Streptomyces coelicolor (215 aa); AAC44003.1|U29587 phosphatidylglycerol phosphate synthase from Rhodobacter sphaeroides (227 aa); NP_405431.1|NC_003143 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase from Yersinia pestis (182 aa); P06978|PGSA_ECOLI CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase from Escherichia coli (181 aa), FASTA scores: opt: 252, E(): 2.8e-09, (29.7% identity in 175 aa overlap); etc. Also similar to Rv2746c|PGSA3|MTV002.11c CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (PGP synthase) from Mycobacterium tuberculosis (209 aa). Contains PS00379 CDP-alcohol phosphatidyltransferases signature; and PS00075 Dihydrofolate reductase signature. Belongs to the CDP-alcohol phosphatidyltransferase class-I family.
Functional categoryLipid metabolism
ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
MutantEssential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS20690802069709+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1822|pgsA2
MEPVLTQNRVLTVPNMLSVIRLALIPAFVYVVLSAHANGWGVAILVFSGVSDWADGKIARLLNQSSRLGALLDPAVDRLYMVTVPIVFGLSGIVPWWFVLTLLTRDALLAGTLPLLWSRGLSALPVTYVGKAATFGFMVGFPTILLGQCDPLWSHVLLACGWAFLIWGMYAYLWAFVLYAVQMTMVVRQMPKLKGRAHRPAAQNAGERG