Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductProbable hydrolase
CommentsRv1834, (MTCY1A11.09c), len: 288 aa. Probable lipZ, hydrolase, some similarity to haloalkane dehalogenases and D16262 hypothetical 38.9 kDa protein (335 aa), FASTA scores: opt: 507, E(): 7.6e-28, (33.0% identity in 300 aa overlap).
Functional categoryIntermediary metabolism and respiration
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS20798302080696+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1834|lipZ
VTSPSVREWRDGGRWLPTAVGKVFVRSGPGDTPTMLLLHGYPSSSFDFRAVIPHLTGQAWVTMDFLGFGLSDKPRPHRYSLLEQAHLVETVVAHTVTGAVVVLAHDMGTSVTTELLARDLDGRLPFDLRRAVLSNGSVILERASLRPIQKVLRSPLGPVAARLVSRGGFTRGFGRIFSPAHPLSAQEAQAQWELLCYNDGNRIPHLLISYLDERIRHAQRWHGAVRDWPKPLGFVWGLDDPVATTNVLNGLRELRPSAAVVELPGLGHYPQVEAPKAYAEAALSLLVD