Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductProbable conserved integral membrane protein
CommentsRv1863c, (MTCY359.10), len: 256 aa. Probable conserved integral membrane protein, similar to Rv0804|Z95618|MTCY7H7A.05 Hypothetical protein from Mycobacterium tuberculosis (209 aa), FASTA scores: opt: 199, E(): 1e-06, (33.2% identity in 220 aa overlap); and Rv0658c.
Functional categoryCell wall and cell processes
MutantNon-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS21105912111361-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1863c|Rv1863c
MSDHLTACAAVHPGPLVSHLSVMHRFRIYVDIAVVVLVLVLTNLIAHFTTPWASIATVPAAAVGLVILVRSRGLGWAELGLSRQHWKSGLVYALAAVALVVAVISVGVLLPITRPMFMNHHYATISGAVIASMVMIPLQTVIPEELAFRGVLHGALNRAWGFRGVAVAGSVLFGLWHIATSLGLTSSNVGFTRLFGGGIIGLVAGVMLAVLATGVAGFVFSWLRRRSGSLIAPIALHWSLNGMGALAAALVWHLST