Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown; probably involved in cellular metabolism
ProductProbable short-chain type dehydrogenase
CommentsRv1865c, (MTCY359.08), len: 286 aa. Probable short-chain dehydrogenase, highly similar to C-terminus of NP_301650.1|NC_00267 putative oxidoreductase from Mycobacterium leprae (596 aa). Also similar to various dehydrogenases, generally belonging to short-chain family, e.g. AAG02168.1|AF212041_24|AF212041 3-oxoacyl-(acylcarrier protein) reductase from Zymomonas mobilis (251 aa); P50198|LINX_PSEPA 2,5-dichloro-2,5-cyclohexadiene-1,4-DIOL dehydrogenase from Sphingomonas paucimobilis (250 aa); NP_105680.1|NC_002678 sorbitol dehydrogenase (also similar to acetoin reductase) from Mesorhizobium loti (256 aa); etc. And highly similar to C-terminus of ephD|Rv2214c|MTCY190.25c from Mycobacterium tuberculosis (592 aa); and many other oxidoreductases from Mycobacterium tuberculosis e.g. Y00P_MYCTU|Q10402 putative oxidoreductase (650 aa), FASTA scores: opt: 439, E(): 8.9e-20, (32.5% identity in 280 aa overlap). Contains PS00061 Short-chain alcohol dehydrogenase family signature. Belongs to the short-chain dehydrogenases/reductases (SDR) family.
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS21121062112966-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1865c|Rv1865c
VPGRTSIGVKIRDKVQDKVIAITGGARGIGLATAAALHNLGAKVAIGDIDEAMAKESGADLDLDMYGKLDVTDPDSFSGFLDAVERQLGPIDVLVNNAGIMPVGRIVDEPDPVTRRILDINVYGVILGSKLAAQRMVPRGRGHVINVASLAGEIYAVGVATYCASKHAVVAFTDSARLEYRSAGVKFSMVLPSFVNTELIAGTGGIKGFKNAEPADIADAIVGLIVHPKPRVRVTKAAGSMIVAQRFMPRQVSEGLNRLLGGEHVFTDDVDMEKRRTYEARARGEE