Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in respiration; catalyzes conversion of lactate into pyruvate [catalytic activity: (S)-lactate + 2 ferricytochrome C = pyruvate + 2 ferrocytochrome C].
ProductPossible L-lactate dehydrogenase (cytochrome) LldD2
CommentsRv1872c, (MTCY180.46, MTCY359.01), len: 414 aa (start uncertain). Possible lldD2, L-lactate dehydrogenase (cytochrome), similar to other lactate dehydrogenases and other oxidases e.g. LLDD_ECOLI|P33232 l-lactate dehydrogenase (cytochrome) from Escherichia coli strain K12 (396 aa), FASTA results: opt: 674, E(): 1.1e-37, (40.5% identity in 279 aa overlap); Q51135 lactate dehydrogenase from Neisseria meningitidis (390 aa), FASTA results: opt: 309, E(): 4.1e-15, (42.5% identity in 113 aa overlap); etc. Also shows similarity with Rv0694|lldD1|MTCY210.11 possible L-lactate dehydrogenase (cytochrome) from Mycobacterium tuberculosis (396 aa). Contains PS00557 FMN-dependent alpha-hydroxy acid dehydrogenases active site. Belongs to the FMN-dependent alpha-hydroxy acid dehydrogenases family. Phosphorylated in vitro by PknJ|Rv2088 (See Arora et al., 2010).
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified in Triton X-114 extracts of M. tuberculosis H37Rv membranes using 2DGE and MALDI-MS (See Sinha et al., 2002). Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the cell wall and cell membrane fractions of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS (See Xiong et al., 2005). Identified in both the aqueous and detergent phases of Triton X-114 extracts of M. tuberculosis H37Rv membranes using 1-DGE and MALDI-TOF-MS (See Sinha et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
TranscriptomicsmRNA identified by DNA microarray analysis and possibly down-regulated by hspR|Rv0353 (see citation below).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS21219072123151-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1872c|lldD2
MAVNRRVPRVRDLAPLLQFNRPQFDTSKRRLGAALTIQDLRRIAKRRTPRAAFDYADGGAEDELSIARARQGFRDIEFHPTILRDVTTVCAGWNVLGQPTVLPFGIAPTGFTRLMHTEGEIAGARAAAAAGIPFSLSTLATCAIEDLVIAVPQGRKWFQLYMWRDRDRSMALVRRVAAAGFDTMLVTVDVPVAGARLRDVRNGMSIPPALTLRTVLDAMGHPRWWFDLLTTEPLAFASLDRWPGTVGEYLNTVFDPSLTFDDLAWIKSQWPGKLVVKGIQTLDDARAVVDRGVDGIVLSNHGGRQLDRAPVPFHLLPHVARELGKHTEILVDTGIMSGADIVAAIALGARCTLIGRAYLYGLMAGGEAGVNRAIEILQTGVIRTMRLLGVTCLEELSPRHVTQLRRLGPIGAPT
      
Bibliography