Gene Rv1884c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Thought to promote the resuscitation and growth of dormant, nongrowing cell. Could also stimulates the growth of several other high G+C gram+ organisms, e.g. Mycobacterium avium, Mycobacterium bovis (BCG), Mycobacterium kansasii, Mycobacterium smegmatis. |
| Product | Probable resuscitation-promoting factor RpfC |
| Comments | Rv1884c, (MTCY180.34), len: 176 aa. Probable rpfC, resuscitation promoting factor (see citation below), similar to Z96935|MLRPF_1 resusicitation-promoting factor from Micrococcus luteus (220 aa), FASTA score: opt: 287, E() : 3.3e-11, (40.0% identity in 120 aa overlap). Also similar to others from Mycobacterium tuberculosis: Rv2389c|MTCY253.32|RPFD probable resuscitation-promoting factor (154 aa), FASTA score: opt: 382, E(): 7.1e-17, (55.4% identity in 101 aa overlap); Rv0867c|RPFA (N-terminal part), Rv2450c|RPFE, and Rv1009|RPFB (C-terminal part). Predicted possible vaccine candidate (See Zvi et al., 2008). |
| Functional category | Cell wall and cell processes |
| Proteomics | Predicted secreted protein - identified in culture filtrates of M. tuberculosis H37Rv; signal peptide predicted (See Malen et al., 2007). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 30 days but not 90 days (See Kruh et al., 2010). Identified by mass spectrometry in the culture filtrate, membrane protein fraction, and whole cell lysates of M. tuberculosis H37Rv (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Non essential gene by specialized transduction in M. tuberculosis Erdman; growth and persistence of mutant in mice are not attenuated (See Tufariello et al., 2004). M. tuberculosis H37Rv rpfACBD, rpfACBE, rpfACDE, and rpfACBED mutants show no growth defects in broth culture; growth of rpfACBD and rpfACBE mutants in human peripheral blood mononuclear cells is unaffected but growth in B6D2/F1 mice is attenuated (See Kana et al., 2008). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2133731 | 2134261 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1884c|rpfC
VHPLPADHGRSRCNRHPISPLSLIGNASATSGDMSSMTRIAKPLIKSAMAAGLVTASMSLSTAVAHAGPSPNWDAVAQCESGGNWAANTGNGKYGGLQFKPATWAAFGGVGNPAAASREQQIAVANRVLAEQGLDAWPTCGAASGLPIALWSKPAQGIKQIINEIIWAGIQASIPR
Bibliography
- Mukamolova GV et al. [1998]. A bacterial cytokine. Secondary Function
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Tufariello JM et al. [2004]. Individual Mycobacterium tuberculosis resuscitation-promoting factor homologues are dispensable for growth in vitro and in vivo. Mutant
- Raman S, Hazra R, Dascher CC and Husson RN [2004]. Transcription regulation by the Mycobacterium tuberculosis alternative sigma factor SigD and its role in virulence. Regulon
- Målen H et al. [2007]. Comprehensive analysis of exported proteins from Mycobacterium tuberculosis H37Rv. Proteomics
- Kana BD et al. [2008]. The resuscitation-promoting factors of Mycobacterium tuberculosis are required for virulence and resuscitation from dormancy but are collectively dispensable for growth in vitro. Mutant
- Zvi A et al. [2008]. Whole genome identification of Mycobacterium tuberculosis vaccine candidates by comprehensive data mining and bioinformatic analyses. Immunology
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- Kruh NA et al. [2010]. Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant