Gene Rv1887
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Hypothetical protein |
| Comments | Rv1887, (MTCY180.31), len: 380 aa. Hypothetical unknown protein; contains eukaryotic thiol (cysteine) proteases histidine active site at N-terminus (PS00639) and Pro-rich region near C-terminus. |
| Functional category | Conserved hypotheticals |
| Proteomics | Identified in culture filtrates of M. tuberculosis H37Rv (See Malen et al., 2007). |
| Transcriptomics | mRNA identified by microarray analysis and down-regulated after 24h of starvation (see citation below). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2136258 | 2137400 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1887|Rv1887
LDTVLGLSITPTTLGWVLAEGHGADGAILDRNELELHSGRNAQAIHTAEQLAAEVLLAHEVAAAGDHRLRVIGVTWNAEASAQAALLVESLTGAGFDNVVPVRRLRAIETLAQAIAPVIGYEQIAVCVLEHESATVVMVDTHDGKTQIAVKHVCRGLSGLTSWLTGMFGRDAWRPAGVVVVGSDSEVSEFSWQLERVLPVPVFAQTMAQVTVARGAALAAAQSTEFTDAQLVADSVSQPTVAPRRSRHYAGAAAALAAAAVTFVASLSLAVGIQLAPHNDTGTAKHGAHKPTPRIAKAVAPAVPPPPTVTPPVPARAPRPAAQHEPPARVTSGEALTEPNPPEEQPNASAPQQDRNDSQPITRVLEHIPGAYGDSAPPAE
Bibliography
- Betts JC et al. [2002]. Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Transcriptome
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Målen H et al. [2007]. Comprehensive analysis of exported proteins from Mycobacterium tuberculosis H37Rv. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
