Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductHypothetical protein
CommentsRv1890c, (MTCY180.28), len: 203 aa. Hypothetical unknown protein. Predicted to be an outer membrane protein (See Song et al., 2008).
Functional categoryConserved hypotheticals
ProteomicsIdentified in the cytosol of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005).
OperonRv1890c and Rv1889c are co-transcribed, by RT-PCR (See Arnvig and Young, 2009).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS21390762139687-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1890c|Rv1890c
VAHKTRREGRAGRSSEYSRGVSDAVWTLDASDGELVLRTGVVGRAARLGHRLTIAMTRWQALVNWSGTDPVAGELVAEVDSFEVMRGEGGVKGLSEPEKALVRANALKTLNASRFPHIRFTTEAIAQTGNGYRLTGKLHIRGKSREHVIDLHTEDLGAAWRISADTTVRQSNYGVKPYSLLMGSIRVADEVSVAFTAVRAKDD