Gene Rv1890c
in Mycobacterium tuberculosis H37Rv
General annotation
Type | CDS |
Function | Unknown |
Product | Hypothetical protein |
Comments | Rv1890c, (MTCY180.28), len: 203 aa. Hypothetical unknown protein. Predicted to be an outer membrane protein (See Song et al., 2008). |
Functional category | Conserved hypotheticals |
Proteomics | Identified in the cytosol of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). |
Operon | Rv1890c and Rv1889c are co-transcribed, by RT-PCR (See Arnvig and Young, 2009). |
Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 2139076 | 2139687 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
>Mycobacterium tuberculosis H37Rv|CDS|Rv1890c|2139076-2139687|-|Rv1890c|downstream:0|upstream:0 gtggcccacaagacgcggcgggaggggcgggcaggcaggtcgtctgaatacagtcgtggcgtgagcgacgcggtgtggactcttgatgcttccgacggcgagctggtacttcgcaccggagtcgttggcagagccgcgcgcttgggtcatcgcctgaccatcgcgatgacacggtggcaggccctggtgaactggtccggcaccgatcccgtcgccggcgagcttgtggctgaggtggattccttcgaggtgatgcgcggtgagggtggcgtgaaggggctgtccgagcctgagaaagctctggtgcgggcgaacgcgctgaaaacgctcaacgccagccgcttcccccatattcgctttaccacggaagccattgcccagaccgggaatgggtaccgcctgaccgggaaactgcacatccggggaaagtcgcgagaacacgtcatcgacttgcacacagaggatcttggtgctgcgtggcgcatctctgccgacaccacggttcgccagtccaactacggcgtcaaaccctactcgctgttgatgggttcaatacgggtcgccgacgaagtgagcgtggcattcaccgcggttcgggcaaaggacgattga
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1890c|Rv1890c VAHKTRREGRAGRSSEYSRGVSDAVWTLDASDGELVLRTGVVGRAARLGHRLTIAMTRWQALVNWSGTDPVAGELVAEVDSFEVMRGEGGVKGLSEPEKALVRANALKTLNASRFPHIRFTTEAIAQTGNGYRLTGKLHIRGKSREHVIDLHTEDLGAAWRISADTTVRQSNYGVKPYSLLMGSIRVADEVSVAFTAVRAKDD
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Song H, Sandie R, Wang Y, Andrade-Navarro MA and Niederweis M [2008]. Identification of outer membrane proteins of Mycobacterium tuberculosis. Localization
- Arnvig KB et al. [2009]. Identification of small RNAs in Mycobacterium tuberculosis. Operon
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant