Gene Rv1896c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv1896c, (MTCY180.22), len: 303 aa. Conserved hypothetical protein. Similar to several (14) hypothetical Mycobacterium tuberculosis proteins e.g. Rv0145|MTCI5.19 (317 aa), FASTA results: opt: 720, E(): 0, (41.6% identity in 308 aa overlap); Q10552|YZ21_MYCTU (325 aa), opt: 689, E(): 0, (40.5% identity in 304 aa overlap); Rv0726c, Rv0731c, Rv3399, etc. and to related proteins in other actinomycetes. Note that there is a substantial (134 bp) overlap at the C-terminus with the C-terminus of the downstream ORF, although both appear to be true coding regions. |
| Functional category | Conserved hypotheticals |
| Proteomics | Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2143535 | 2144446 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1896c|Rv1896c
MTTPEYGSLRSDDDHWDIVSNVGYTALLVAGWRALHTTGPKPLVQDEYAKHFITASADPYLEGLLANPRTSEDGTAFPRLYGVQTRFFDDFFNCADEAGIRQAVIVAAGLDCRAYRLDWQPGTTVFEIDVPKVLEFKARVLSERGAVPKAHRVAVPADLRTDWPTPLTAAGFDPQRPSAWSVEGLLPYLTGDAQYALFARIDELCAPGSRVALGALGSRLDHEQLAALETAHPGVNMSGDVNFSALTYDDKTDPVEWLVEHGWAVDPVRSTLELQVGYGLTPPDVDVKIDSFMRSQYITAVRA
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant