Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved hypothetical protein
CommentsRv1896c, (MTCY180.22), len: 303 aa. Conserved hypothetical protein. Similar to several (14) hypothetical Mycobacterium tuberculosis proteins e.g. Rv0145|MTCI5.19 (317 aa), FASTA results: opt: 720, E(): 0, (41.6% identity in 308 aa overlap); Q10552|YZ21_MYCTU (325 aa), opt: 689, E(): 0, (40.5% identity in 304 aa overlap); Rv0726c, Rv0731c, Rv3399, etc. and to related proteins in other actinomycetes. Note that there is a substantial (134 bp) overlap at the C-terminus with the C-terminus of the downstream ORF, although both appear to be true coding regions.
Functional categoryConserved hypotheticals
ProteomicsIdentified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS21435352144446-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1896c|Rv1896c
MTTPEYGSLRSDDDHWDIVSNVGYTALLVAGWRALHTTGPKPLVQDEYAKHFITASADPYLEGLLANPRTSEDGTAFPRLYGVQTRFFDDFFNCADEAGIRQAVIVAAGLDCRAYRLDWQPGTTVFEIDVPKVLEFKARVLSERGAVPKAHRVAVPADLRTDWPTPLTAAGFDPQRPSAWSVEGLLPYLTGDAQYALFARIDELCAPGSRVALGALGSRLDHEQLAALETAHPGVNMSGDVNFSALTYDDKTDPVEWLVEHGWAVDPVRSTLELQVGYGLTPPDVDVKIDSFMRSQYITAVRA