Gene Rv1903
in Mycobacterium tuberculosis H37Rv
General annotation
Type | CDS |
Function | Unknown |
Product | Probable conserved membrane protein |
Comments | Rv1903, (MTCY180.15c), len: 134 aa. Probable conserved membrane protein, similar to Q53868|YPT3_STRCO hypothetical 15.9 kDa protein from Streptomyces coelicolor (148 aa) opt: 323, E(): 1.3e-16, (42.9% identity in 126 aa overlap); and equivalent to AJ000521|MLCOSL672_3 from Mycobacterium leprae (139 aa), FASTA results: opt: 680, E(): 0, (80.6% identity in 129 aa overlap). |
Functional category | Cell wall and cell processes |
Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 2150364 | 2150768 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1903|Rv1903 MVPFLMRAAVTGFALWVVTLFVPGMRFAGGDTTLQRVAIIFVVAVIFGLVNAFIKPIVQILSIPLYILTLGLFHVVVNASMLWLTAWITEHTTHWGLQIDHFWWTAIWAAILLSIVSWILSLLARDFRRVTRAH
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant