Gene Rv1931c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in transcriptional mechanism |
| Product | Probable transcriptional regulatory protein |
| Comments | Rv1931c, (MTCY09F9.33), len: 259 aa. Probable transcriptional regulatory protein. Similarity in C-terminal half to transcriptional activators e.g. Q43970 AraC-like protein (227 aa), FASTA scores: opt: 238, E(): 7.1e-07, (42.4% identity in 92 aa overlap). Similar to many probable transcription regulators in Streptomyces e.g. AL049587|SC5F2A.29 Streptomyces coelicolor (325 aa), FASTA scores: opt: 387, E(): 3.2e-16, (34.4% identity in 259 aa overlap). |
| Functional category | Regulatory proteins |
| Proteomics | Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Required for growth in C57BL/6J mouse spleen, by transposon site hybridization (TraSH) in H37Rv (See Sassetti and Rubin, 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2182460 | 2183239 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1931c|Rv1931c
VVIVGFPGDPVDTVILPGGAGVDAARSEPALIDWVKAVSGTARRVVTVCTGAFLAAEAGLLGRTPSDDALGLCRTFRPRISGRSGRCRPDLHAQFAEGVDRGWSHRRHRPRAGTGRRRPRHRDCPDGCPLARPVSAPTRWADPVRGSGVDATRQTDLDPPGAGGHRGRAGGAHRIGELAQRAAMSPRHFTRVFSDEVGEAPGRYVERIRTEAARRQLEETHDTVVAIAARCGFGTAETMRRSFIRRVGISPDQYRKAFA
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Sassetti CM and Rubin EJ [2003]. Genetic requirements for mycobacterial survival during infection. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant