Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in transcriptional mechanism
ProductProbable transcriptional regulatory protein
CommentsRv1931c, (MTCY09F9.33), len: 259 aa. Probable transcriptional regulatory protein. Similarity in C-terminal half to transcriptional activators e.g. Q43970 AraC-like protein (227 aa), FASTA scores: opt: 238, E(): 7.1e-07, (42.4% identity in 92 aa overlap). Similar to many probable transcription regulators in Streptomyces e.g. AL049587|SC5F2A.29 Streptomyces coelicolor (325 aa), FASTA scores: opt: 387, E(): 3.2e-16, (34.4% identity in 259 aa overlap).
Functional categoryRegulatory proteins
ProteomicsIdentified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Required for growth in C57BL/6J mouse spleen, by transposon site hybridization (TraSH) in H37Rv (See Sassetti and Rubin, 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS21824602183239-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1931c|Rv1931c
VVIVGFPGDPVDTVILPGGAGVDAARSEPALIDWVKAVSGTARRVVTVCTGAFLAAEAGLLGRTPSDDALGLCRTFRPRISGRSGRCRPDLHAQFAEGVDRGWSHRRHRPRAGTGRRRPRHRDCPDGCPLARPVSAPTRWADPVRGSGVDATRQTDLDPPGAGGHRGRAGGAHRIGELAQRAAMSPRHFTRVFSDEVGEAPGRYVERIRTEAARRQLEETHDTVVAIAARCGFGTAETMRRSFIRRVGISPDQYRKAFA