Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionHas antioxidant activity. Could remove peroxides or H(2)O(2)
ProductProbable thiol peroxidase Tpx
CommentsRv1932, (MTCY09F9.32c), len: 165 aa. Probable tpx (alternate gene name: cfp20), thiol peroxidase similar to TPX_ECOLI|P37901 thiol peroxidase (p20) from Escherichia coli (167 aa), fasta scores: opt: 535, E(): 7.3e-25, (52.4% identity in 164 aa overlap). There are four other related enzymes in M. tuberculosis: Rv2428, Rv2521, Rv2238c, Rv1608c.
Functional category-
ProteomicsThe product of this CDS corresponds to spot 3_32 identified in culture supernatant by proteomics at the Max Planck Institute for Infection Biology, Berlin, Germany, and also spots 1932 identified in short term culture filtrate and cell wall by the Statens Serum Institute (Denmark) (see citations below). Identified in immunodominant fractions of both M. tuberculosis H37Rv culture filtrate and cytosol using 2D-LPE, 2D-PAGE, and LC-MS or LC-MS/MS (See Covert et al., 2001). Identified in the culture supernatant of M. tuberculosis H37Rv using mass spectrometry (See Mattow et al., 2003). Identified in culture filtrates of M. tuberculosis H37Rv (See Malen et al., 2007). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the culture filtrate, membrane protein fraction, and whole cell lysates of M. tuberculosis H37Rv (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). M. tuberculosis H37Rv tpx|Rv1932 mutant shows increased sensitivity to oxidative and nitrosative stress in vitro; mutant shows growth defect in lungs and spleen of BALB/c mice; SCID mice infected with mutant live longer than those infected with wild-type; mutant shows growth defect in resting and activated bone marrow-derived macrophages from BALB/c, C57BL/6 and C57BL/6 iNOS-/- mice (See Hu and Coates 2009).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS21833722183869+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1932|tpx
MAQITLRGNAINTVGELPAVGSPAPAFTLTGGDLGVISSDQFRGKSVLLNIFPSVDTPVCATSVRTFDERAAASGATVLCVSKDLPFAQKRFCGAEGTENVMPASAFRDSFGEDYGVTIADGPMAGLLARAIVVIGADGNVAYTELVPEIAQEPNYEAALAALGA
      
Bibliography