Gene Rv1933c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown, but supposed involvement in lipid degradation. |
| Product | Probable acyl-CoA dehydrogenase FadE18 |
| Comments | Rv1933c, (MTCY09F9.31), len: 363 aa. Probable fadE18, acyl-CoA dehydrogenase, similar to many e.g. CAB61609.1|AL133210 putative acyl-CoA dehydrogenase from Streptomyces coelicolor (362 aa); NP_421282.1|NC_002696 acyl-CoA dehydrogenase family protein from Caulobacter crescentus (344 aa); ACDS_RAT|P15651 short-chain specific acyl-CoA dehydrogenase from Rattus norvegicus (Rat) (412 aa), fasta scores: opt: 239, E(): 2.1e-08, (28.4% identity in 331 aa overlap); etc. Also similar to others from Mycobacterium tuberculosis e.g. N-terminus of fadE22 (721 aa); fadE33 (318 aa); N-terminus of fadE34 (711 aa); etc. Could belong to the acyl-CoA dehydrogenases family. |
| Functional category | Lipid metabolism |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2183866 | 2184957 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1933c|fadE18
VDFRYSTEQDDFRASLRGFLGRGAPVREMAAADGSDRRLWQRLCTELELPALHVPPEHGGLGATLVETAIAFAELGRALTPIPFAATVFAIEAILRMGDDEQRKRLLAGLLTGARIGTIAVSGHDVASATTVRAVRRDGRPALTGECTPVLHGHVADLFVVPAVADGSIVLHVVAADAPGVTVTPLPSFDITRPVATLRLAGSPAEPLTAGTPDDMERVLDVARVLLAAEMLGGAEACLDLAVQYAGRRTQFDRPIGSFQAVKHACADMMIEIDATRATVMFAAMSAANGDELQTVAPLAKAQTAETFVLCAGSALQIHGAIAFTWEHDLHLYYRRAKTTEALFGSSARNRALLAERAGLVKA
Bibliography
- de la Paz Santangelo M et al. [2009]. Mce3R, a TetR-type transcriptional repressor, controls the expression of a regulon involved in lipid metabolism in Mycobacterium tuberculosis. Regulon
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
