Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown, but supposed involvement in lipid degradation.
ProductProbable acyl-CoA dehydrogenase FadE18
CommentsRv1933c, (MTCY09F9.31), len: 363 aa. Probable fadE18, acyl-CoA dehydrogenase, similar to many e.g. CAB61609.1|AL133210 putative acyl-CoA dehydrogenase from Streptomyces coelicolor (362 aa); NP_421282.1|NC_002696 acyl-CoA dehydrogenase family protein from Caulobacter crescentus (344 aa); ACDS_RAT|P15651 short-chain specific acyl-CoA dehydrogenase from Rattus norvegicus (Rat) (412 aa), fasta scores: opt: 239, E(): 2.1e-08, (28.4% identity in 331 aa overlap); etc. Also similar to others from Mycobacterium tuberculosis e.g. N-terminus of fadE22 (721 aa); fadE33 (318 aa); N-terminus of fadE34 (711 aa); etc. Could belong to the acyl-CoA dehydrogenases family.
Functional categoryLipid metabolism
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS21838662184957-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1933c|fadE18
VDFRYSTEQDDFRASLRGFLGRGAPVREMAAADGSDRRLWQRLCTELELPALHVPPEHGGLGATLVETAIAFAELGRALTPIPFAATVFAIEAILRMGDDEQRKRLLAGLLTGARIGTIAVSGHDVASATTVRAVRRDGRPALTGECTPVLHGHVADLFVVPAVADGSIVLHVVAADAPGVTVTPLPSFDITRPVATLRLAGSPAEPLTAGTPDDMERVLDVARVLLAAEMLGGAEACLDLAVQYAGRRTQFDRPIGSFQAVKHACADMMIEIDATRATVMFAAMSAANGDELQTVAPLAKAQTAETFVLCAGSALQIHGAIAFTWEHDLHLYYRRAKTTEALFGSSARNRALLAERAGLVKA