Gene Rv1940 (ribA)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in riboflavin biosynthesis [catalytic activity: GTP + 3 H(2)O = formate + 2,5-diamino-6-hydroxy-4-(5-phosphoribosylamino)pyrimidine + diphosphate] |
| Product | Probable riboflavin biosynthesis protein RibA1 (GTP cyclohydrolase II) |
| Comments | Rv1940, (MTCY09F9.24c), len: 353 aa. Probable ribA1, Riboflavin biosynthesis protein, similar to GCH2_BACSU|P17620 gtp cyclohydrolase II (398 aa), FASTA scores: opt: 682, E(): 0, (37.7% identity in 363 aa overlap), also similar to Rv1415|MTCY21B4.33|ribA2 (428 aa) (45.4% identity in 368 aa overlap). Note that previously known as ribA. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). M. tuberculosis Erdman Rv1936-Rv1941 mutant is more susceptible to ROS-generating compounds; shows reduced growth and persistence in C57BL/6 and iNOS-/- mice but not Phox -/- mice; pathology in infected C57BL/6 mice is reduced; mutant shows growth defect in activated J774A.1 murine, human peripheral blood monocyte-derived, and mouse bone marrow-derived macrophages (BMDM), and BMDM from Phox -/- and iNOS -/- mice (See Cirillo et al., 2009). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2192606 | 2193667 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1940|ribA1
MKTTDVRVRRAITAMAGGHAVVLTGDPNGDGYLVFAAQAATPRLVAFAVRHTSGYLRVALPGAECERLHLPPMCDRDTTHCVSVDVRGTGTGISASDRAWTIAALASATSVAADFQRPGHVVPVQAQADGVLGRRGPAEAAVDLARLAERRPAAALCEIVSPDNPVQMAHHAESVEFAVEHGLAMVSIGELVAYRRRIEPQVVRFTAATLPTWAGASRVIGFRDVYDLGEHLAVIVGAVGAGVPVPLHVHIECLTGDVFGSTACRCGEELNGALARMSAQGSGVVLYLRPPGPAQACGLFARGDAATDVMPETVTWILRDLGVYAIRLSDDVPGFGLVMFGAIREASTLAAAG
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- de la Paz Santangelo M et al. [2009]. Mce3R, a TetR-type transcriptional repressor, controls the expression of a regulon involved in lipid metabolism in Mycobacterium tuberculosis. Regulon
- Cirillo SL et al. [2009]. Protection of Mycobacterium tuberculosis from reactive oxygen species conferred by the mel2 locus impacts persistence and dissemination. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant