Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductPossible lipoprotein
CommentsRv1946c, (MTCY09F9.18), len: 150 aa. Possible lppG, conserved lipoprotein, showing some similarity to Rv1943c|MTCY09F9.21 conserved hypothetical protein from Mycobacterium tuberculosis (125 aa), FASTA score: (71.4% identity in 28 aa overlap). Contains PS00013 Prokaryotic membrane lipoprotein lipid attachment site. This region is a possible MT-complex-specific genomic island (See Becq et al., 2007).
Functional categoryCell wall and cell processes
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS21975082197960-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1946c|lppG
MIRGSAVSGLLMPSVNGGTAGSVACVQCLFLPKVAVDLINLSGIQCFARIEHVAHAQAHPFVVLVGKPAQHGARIGAVAGAILTGDVIVSHDGELYRAVTALRQNGPRPHASRRLHAPALCSARSRRGHLRPSCWLPPPRFAGRQSLVAR