Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved hypothetical protein
CommentsRv1950c, (MTCY09F9.14), len: 63 aa. Conserved hypothetical protein, partial ORF. Highly similar to N-terminus of Rv2077c|MTCY49.16C|Q10685 hypothetical 33.3 kDa protein (323 aa), FASTA scores: opt: 280, E(): 1.2 e-16, (71.7% identity in 53 aa overlap) but homology continues in different frame ie MTCY09F9.15, cosmid sequence appears to be correct, genomic sequence is also frameshifted in Mycobacterium bovis strain AF2122/97.
Functional categoryConserved hypotheticals
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Found to be deleted (partially or completely) in one or more clinical isolates (See Tsolaki et al., 2004).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS21999982200189-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1950c|Rv1950c
LLPTLSHIHAWDTEHLIEAAYYWTKVADQWEDVFLEMRNRSHFIAWEGAGGDGCDSEPALTYR